PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc05g015030.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family HD-ZIP
Protein Properties Length: 475aa    MW: 54714.2 Da    PI: 7.5792
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc05g015030.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox54.12.6e-172677556
                        SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox  5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                        ++++ eq+++L ++F+k+++p++++ ++L ++ gL+  qVk+WFqNrRa+ k
  Solyc05g015030.1.1 26 HKYSMEQIQRLDAFFKKCPHPDEDQQKQLGREAGLDHMQVKFWFQNRRAQAK 77
                        6899*********************************************998 PP

2START98.11.7e-311753935206
                         HHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS........SCEEEEEEEECCSCHHHHHHHHHCCCGG...CT-TT-SEEEE CS
               START   5 eaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.......dsgealrasgvvdmvlallveellddke...qWdetlakaet 81 
                         + ++e v + + ++p+Wv ss        ++++ +kf+  +v        ++e ++++g+v m++ +l   +ld  +    + + ++ka+t
  Solyc05g015030.1.1 175 ASMNEMVELWKMKDPFWVDSSsdrrCFIHREIYGRKFSN-QVlppqtstGRIESSKDCGIVSMTAIDLIHNFLDPVKymnLFPTIVTKAKT 264
                         679999999************776633345666666633.45677778889***********************9977888888888**** PP

                         EEEECTT...EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE.-EESSEEEEEEEECTCEEEEEEE CS
               START  82 levissg...galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvR.aellpSgiliepksnghskvtwv 167
                         +ev++sg   g  qlm+ +l  lsplv  R+f f+R+ rql a +w++vd+S d  +  +   +v + + ++pSg++ie+++ng skvtwv
  Solyc05g015030.1.1 265 IEVLDSGtwgGSTQLMYEKLHILSPLVEaREFFFIRCYRQLDATTWILVDISYDIFNGIQC--GVPCySWKFPSGCVIEDMGNGQSKVTWV 353
                         ***************************99*********************99998888654..33332469******************** PP

                         E-EE-.-SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
               START 168 ehvdl.kgrlphwllrslvksglaegaktwvatlqrqcek 206
                         ehv + +++++  ++r l+  + a gak+w  tlqr ce+
  Solyc05g015030.1.1 354 EHVQVyEKYQVNHIFRDLLCDREAYGAKRWIVTLQRMCER 393
                         ***97256778***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.1E-171178IPR009057Homeodomain-like
PROSITE profilePS5007115.1271979IPR001356Homeobox domain
SMARTSM003891.0E-112183IPR001356Homeobox domain
SuperFamilySSF466895.56E-152480IPR009057Homeodomain-like
PfamPF000469.7E-152677IPR001356Homeobox domain
CDDcd000861.20E-122677No hitNo description
PROSITE profilePS5084829.014162396IPR002913START domain
CDDcd088758.95E-74166392No hitNo description
SuperFamilySSF559613.02E-21169394No hitNo description
SMARTSM002347.5E-20171393IPR002913START domain
PfamPF018521.8E-26175393IPR002913START domain
Gene3DG3DSA:3.30.530.207.6E-5229356IPR023393START-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 475 aa     Download sequence    Send to blast
MTDFGEEPAG ESSNLQKRSE RDGQYHKYSM EQIQRLDAFF KKCPHPDEDQ QKQLGREAGL  60
DHMQVKFWFQ NRRAQAKDEK VSNLISHVLG RPFVMDSNFA PQISTLGSSS NSSDGSLLNQ  120
DICGSPIRYP PLRQEKNHKN SIVHAHSMIS PSPQEHDECH HDSRKQTIMF ETVVASMNEM  180
VELWKMKDPF WVDSSSDRRC FIHREIYGRK FSNQVLPPQT STGRIESSKD CGIVSMTAID  240
LIHNFLDPVK YMNLFPTIVT KAKTIEVLDS GTWGGSTQLM YEKLHILSPL VEAREFFFIR  300
CYRQLDATTW ILVDISYDIF NGIQCGVPCY SWKFPSGCVI EDMGNGQSKV TWVEHVQVYE  360
KYQVNHIFRD LLCDREAYGA KRWIVTLQRM CERFNFQMGS TYPTRHDFKG EGLKNTIKVS  420
QRMVKKFFEI LSMTDNHGDF SISPQLNRGD RISIRKNEEI IQPKGFIAIA TTSL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0109300.0Solanum lycopersicum DNA, chromosome 8, clone: C08SLe0034G06, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010320996.10.0PREDICTED: homeobox-leucine zipper protein HDG8-like isoform X2
TrEMBLK4BYM10.0K4BYM1_SOLLC; Uncharacterized protein
STRINGSolyc05g015030.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10211732
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17920.14e-71homeodomain GLABROUS 12
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]